ITGB7 (Integrin B7, Integrin beta-7, Gut Homing Receptor beta Subunit)

Size

£685.00

SKU:: 128647
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa401-505 from human ITGB7 (NP_000880) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Integrin B7 is a 130kD glycoprotein, also known as integin Bp. It is a member of the Ig superfamily. In association with integrin a4 or aE chain, B7 forms a4/B7 or aE/B7 heterodimer. a4/B7 (CD49d/B7, LPAM-1) is expressed on majority of peripheral lymphocytes, small subsets of thymocytes and bone marrow progenitors. LPAM-1 binds to several ligands, VCAM-1, MAdCAM-1 and fibronectin, and is involved in lymphocyte adhesion, some hematopoietic progenitor cells migration. aE/B7 (CD103/B7,aIEL/B7) is expressed on intestinal intraepithelial lymphocytes (IEL), dendritic epidermal T cells, T regulatory cells, a subset of CD8+ T cells in lymph nodes and lamina propria. CD103/B7 complex is thought to play a role in lymphocyte retention via interaction with its lignd E-Cadherin. This antibody has been reported to react with mouse and human B7 integrin and to block B7 integrin-mediated cell adhesion in in vitro and in vivo studies. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice