128647-BIOTIN

ITGB7 (Integrin B7, Integrin beta-7, Gut Homing Receptor beta Subunit) (Biotin)

Size

£914.00

SKU:: 128647-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa401-505 from human ITGB7 (NP_000880) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8D3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Integrin B7 is a 130kD glycoprotein, also known as integin Bp. It is a member of the Ig superfamily. In association with integrin a4 or aE chain, B7 forms a4/B7 or aE/B7 heterodimer. a4/B7 (CD49d/B7, LPAM-1) is expressed on majority of peripheral lymphocytes, small subsets of thymocytes and bone marrow progenitors. LPAM-1 binds to several ligands, VCAM-1, MAdCAM-1 and fibronectin, and is involved in lymphocyte adhesion, some hematopoietic progenitor cells migration. aE/B7 (CD103/B7,aIEL/B7) is expressed on intestinal intraepithelial lymphocytes (IEL), dendritic epidermal T cells, T regulatory cells, a subset of CD8+ T cells in lymph nodes and lamina propria. CD103/B7 complex is thought to play a role in lymphocyte retention via interaction with its lignd E-Cadherin. This antibody has been reported to react with mouse and human B7 integrin and to block B7 integrin-mediated cell adhesion in in vitro and in vivo studies. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice