ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658)

Size

£685.00

SKU:: 128641
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa421-516 from human ITGB5 (NP_002204) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Integrins are heterodimers composed of non-covalently associated transmembrane alpha and beta subunits. Most integrin receptors bind ligands, components of the extracellular matrix, including fibronectin, collagen and vitronectin. Ligands serve to cross-link or cluster integrins by binding to adjacent integrin receptors. In addition to mediating cell adhesion and cytoskeletal organization, integrins function as signaling receptors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.