128641-PE
ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658) (PE)
Size
£914.00
- SKU:
- 128641-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa421-516 from human ITGB5 (NP_002204) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Integrins are heterodimers composed of non-covalently associated transmembrane alpha and beta subunits. Most integrin receptors bind ligands, components of the extracellular matrix, including fibronectin, collagen and vitronectin. Ligands serve to cross-link or cluster integrins by binding to adjacent integrin receptors. In addition to mediating cell adhesion and cytoskeletal organization, integrins function as signaling receptors. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice