ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996)

Size

£685.00

SKU:: 128631
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa57-171 from human ITGAE (NP_002199) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. ITGAE encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice