IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187)

Size

£685.00

SKU:: 128595
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa182-286 from human IRX3 (NP_077312) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcription factor. Involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenitor factors, which are repressed by SHH signals. Involved in the transcriptional repression of MNX1 in non-motor neuron cells. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.