128588-HRP

IRF4 (Multiple Myeloma Oncogene 1, NF-EM5, Lymphocyte-specific Interferon Regulatory Factor, LSIRF, Interferon Regulatory Factor 4, IRF-4, IRF4, MUM1, FLJ14868, FLJ22283, HSPC211, MGC131891, MGC163315, MUM-1) (HRP)

Size

£914.00

SKU:: 128588-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa342-451 from human IRF4 (NP_002451) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: IRF4 is a transcriptional activator. It Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter and binds the immunoglobulin lambda light chain enhancer, together with PU.1. This protein probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice