IPR1 (SP110, Sp110 Nuclear Body Protein, Interferon-induced Protein 41/75, Speckled 110kD, Transcriptional Coactivator Sp110)

Size

£685.00

SKU:: 128559
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa271-380 from human SP110 (NP_004501) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice