IP6K2 (Inositol Hexakisphosphate Kinase 2, InsP6 Kinase 2, P(i)-uptake Stimulator, PiUS, IHPK2, TCCCIA00113)

Size

£685.00

SKU:: 128554
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-71 from human IP6K2 (NP_001005912) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.