128551-HRP

Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derived Neutrophil Chemotactic Factor, MDNCF, Neutrophil Activating Factor, NAF, Neutrophil Activating Peptide 1, Neutrophil Activating Protein 1, NAP-1, NAP1, Protein 3-10C, SCYB8, T cell Chemotactic Factor, TSG1) (HRP)

Size

£914.00

SKU:: 128551-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa21-99 from IL8 (AAH13615.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: IL-8, also known as CXCL8, is produced by a range of cells including stimulated monocytes, mast cells, endothelial cells, keratinocytes and fibroblasts. IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice