128551-APC
Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derived Neutrophil Chemotactic Factor, MDNCF, Neutrophil Activating Factor, NAF, Neutrophil Activating Peptide 1, Neutrophil Activating Protein 1, NAP-1, NAP1, Protein 3-10C, SCYB8, T cell Chemotactic Factor, TSG1) (APC)
Size
£927.00
- SKU:
- 128551-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa21-99 from IL8 (AAH13615.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 6D12
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- IL-8, also known as CXCL8, is produced by a range of cells including stimulated monocytes, mast cells, endothelial cells, keratinocytes and fibroblasts. IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice