128542
Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16)
Size
£760.00
- SKU:
- 128542
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human IL24, aa1-206 (NP_006841.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Interleukin 24 (IL-24), also known as mda-7 (melanoma differentiation associated gene-7), is a newly discovered member of the IL-10 family of helical cytokines. The IL-24 gene encodes a precursor protein of 207 amino acids (aa) that contains a 48 aa signal sequence and an 18kD, 158 aa mature segment. There are three potential N-linked glycosylation sites, at least one of which is used. When secreted, IL-24 is a 35-40kD phosphorylated glycoprotein that apparently can exist as either a monomer or dimer. It is suggested that glycosylation is essential for activity. Mature human IL-24 shares 69% aa sequence identity with mouse and rat IL-24. Human IL-24 is active in rodent systems. Cells known to express IL-24 include B cells, CD4+ T cells, NK cells, lymph node dendritic cells, monocytes, melanocytes, and melanoma cells. Functionally, IL-24 has diverse activities. At low concentrations on monocytes, it induces type I proinflammatory cytokines such as IFN-gamma, IL-1Beta, IL-12 and TNF-alpha. At high concentrations, it is a strong inducer of apoptosis in tumor cells, but not in normal cells. IL-24 also has anti-angiogenic properties. It binds directly to IL-24 receptors on endothelial cells, activating STAT3 and blocking their differentiation. IL-24 binds and signals through two heterodimeric receptor complexes. One complex is the combination of IL-20 Ralpha. and IL-20 RBeta, which is shared with IL-19 and IL-20. The second complex is a combination of IL-22 R and IL-20 RBeta, which is shared with IL-20. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice