IL6ST (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta)

Size

£685.00

SKU:: 128477
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa23-122 from human IL6ST (NP_002175) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: IL6ST is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated Herpes virus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice