IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402)

Size

£685.00

SKU:: 128469
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa63-153 from human IL4 (NP_000580) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: IL-4 is a potent lymphoid cell growth factor that stimulates the growth and survivability of certain B cells and T cells. Human IL-4 is a 15kD globular protein containing 130aa residues. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.