IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25)

Size

£685.00

SKU:: 128459
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-122 from human IL2RA (NP_000408) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: IL-2 receptor alpha (IL-2 RA), also known as CD25, is a 55kD type I membrane glycoprotein that belongs to a family of cytokine receptors that utilize the common gamma chain subunit (Gc). IL-2 RA is primarily expressed on activated T cells and on regulatory T cells (Treg). IL-2 RABBIT (CD122) and Gc (IL-2 RG/CD132) dimerize to form a constitutively expressed intermediate affinity IL-2 receptor. By itself, IL-2 RA binds IL-2 with low affinity. It associates with IL-2 RB and GC to generate a ternary high affinity IL-2 receptor complex. A soluble form of IL-2 RA can be generated by proteolytic cleavage of the cell surface receptor, rendering the T cell unresponsive to IL-2. Increased serum levels of soluble IL-2 RA are found in some cancers and immune disorders. IL-2 RA is required for activation-induced cell death (AICD) of naive T cells, a mechanism responsible for deleting autoreactive T cell clones. IL-2 RA is also required for the development of CD4+CD25+ Treg which suppress autoreactive CD4+ T cells, thereby contributing to peripheral T cell homeostasis. Within the ECD, canine IL-2 RA shares 49%-60% aa sequence identity with human, mouse, and rat IL-2 RA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice