128449
IL23A (Interleukin-23 Subunit alpha, IL-23 Subunit alpha, IL-23-A, Interleukin-23 Subunit p19, IL-23p19, SGRF, UNQ2498/PRO5798, MGC79388, P19, SGRF)
Size
£685.00
- SKU:
- 128449
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa1-189 of human IL23A.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This monoclonal antibody recognizes human IL-23, a heterodimeric cytokine composed of the p40 subunit shared with IL-12 and a specific p19 subunit. This antibody recognizes heterodimeric IL-23, but does not react with the p40 subunit alone or recombinant IL-12(p70) when used as a capture antibody in ELISA. IL-23 is secreted by activated dendritic cells and macrophages and has been shown to enhance IFN-y secretion by memory (CD45RO) T cells in an IL-2 dependent manner. IL-23 may also induce unique Th subset (designated ThIL-17) that secretes the cytokines IL-17, IL-6, TNF and low levels of IFN-y. IL-23 has been shown to promote immunity to mycobacteria and has been shown to be upregulated in response to some viral infections and in psoriatic lesions. IL-23 binds to the IL-23 receptor comprised of a B1 subunit shared with the IL-12 receptor and IL-23-specific subunit. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice