IL22 (Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible Factor, IL-TIF, ILTIF, ZCYTO18, UNQ3099/PRO10096, MGC79382, MGC79384)

Size

£760.00

SKU:: 128445
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human IL22, aa1-179 (NP_065386.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Cytokine that contributes to the inflammatory response in vivo. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.