IL1RN (Interleukin-1 Receptor Antagonist Protein, IL-1ra, IL-1RN, IRAP, IL1 Inhibitor, ICIL-1RA, Anakinra, IL1RA, IL1F3, MGC10430)

Size

£685.00

SKU:: 128441
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-159 from human IL1RN (AAH09745) with GST tag. MW of the GST tag alone is 26kD.
Clone:: M1-B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The protein is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. A polymorphism of its gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.