IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP)

Size

£685.00

SKU:: 128417
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-122 from human IL18R1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C8
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Interleukin 18 receptor alpha is a member of the IL-1 receptor superfamily and has been designated IL-1 R5. Along with IL-1 R7, it forms a heterodimeric receptor for IL-18. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.