128417-ML490
IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP) (MaxLight 490)
Size
£914.00
- SKU:
- 128417-ML490
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa22-122 from IL18R1 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3C8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Interleukin 18 receptor alpha is a member of the IL-1 receptor superfamily and has been designated IL-1 R5. Along with IL-1 R7, it forms a heterodimeric receptor for IL-18. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice