128417-BIOTIN

IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP) (Biotin)

Size

£914.00

SKU:: 128417-BIOTIN
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-122 from IL18R1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Interleukin 18 receptor alpha is a member of the IL-1 receptor superfamily and has been designated IL-1 R5. Along with IL-1 R7, it forms a heterodimeric receptor for IL-18. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.