128412-ML490
IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (MaxLight 490)
Size
£914.00
- SKU:
- 128412-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa31-140 from human IL17F (NP_443104) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1E5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Interleukin 17 (IL-17) is a pro-inflammatory cytokine produced by a subset of T helper cells that develops distinct from the Th1- and Th2- cell differentiation pathways. IL-17, also known as CTLA-8, stimulates induction of other pro-inflammatory cytokines TNF alpha, IL-1 beta, IL-6, and IL-8, and reports strongly suggest the involvement of IL-17 in several chronic inflammatory diseases such as rheumatoid arthritis, psoriasis and multiple sclerosis. TGF-ß (differentiation) and IL-23 (expansion) are required for induction and maintenance of Th17 (IL-17 producing) cells, which in turn induce the other pro-inflammatory cytokines. IL-17 (~32kD) protein is produced and exists as a homo-dimer, has homology to a herpes virus early protein, is one of the six members (IL-17A-F) of this cytokine family, and is well characterzed and highly expressed by activated effector memory T cells. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice