IL15 (Interleukin 15, Interleukin-15, IL-15, MGC9721)

Size

£685.00

SKU:: 128398
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa49-162 from human IL15 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Interleukin-15 is a potent immunoregulatory cytokine produced by a variety of cell types including monocytes, epithelial cells and fibroblasts. IL-15 shares many of its biological properties with IL-2 including T, B and NK cell stimulation and has also been demonstrated to promote division of CD8 memory cells and activate IL4 production in bone marrow-derived mast cells. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.