128398-APC
IL15 (Interleukin 15, Interleukin-15, IL-15, MGC9721) (APC)
Size
£927.00
- SKU:
- 128398-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa49-162 from human IL15 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Interleukin-15 is a potent immunoregulatory cytokine produced by a variety of cell types including monocytes, epithelial cells and fibroblasts. IL-15 shares many of its biological properties with IL-2 including T, B and NK cell stimulation and has also been demonstrated to promote division of CD8 memory cells and activate IL4 production in bone marrow-derived mast cells. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice