IL15 (Interleukin 15, Interleukin-15, IL-15, MGC9721)

Size

£760.00

SKU:: 128397
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human IL15, aa1-162 (NP_000576.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Interleukin-15 is a potent immunoregulatory cytokine produced by a variety of cell types including monocytes, epithelial cells and fibroblasts. IL-15 shares many of its biological properties with IL-2 including T, B and NK cell stimulation and has also been demonstrated to promote division of CD8 memory cells and activate IL4 production in bone marrow-derived mast cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.