IL11 (Interleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin)

Size

£685.00

SKU:: 128383
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa25-74 from human IL11 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: ELISA: The detection limit is ~0.3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.