IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Transcription Factor 16, TCF-16, CHUK, IKKA, TCF16)

Size

£685.00

SKU:: 128369
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa646-745 from human CHUK (NP_001269) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: IKK alpha is a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.