IGSF1 (IGDC1, KIAA0364, PGSF2, Immunoglobulin Superfamily Member 1, Immunoglobulin-like Domain-containing Protein 1, Inhibin-binding Protein, Pituitary Gland-specific Factor 2, p120, MGC75490)

Size

£685.00

SKU:: 128352
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa220-310 from human IGSF1 (NP_001546) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes a member of the immunoglobulin-like domain-containing superfamily. Proteins in this superfamily contain varying numbers of immunoglobulin-like domains and are thought to participate in the regulation of interactions between cells. Multiple transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.