128335-ML550
IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (MaxLight 550)
Size
£914.00
- SKU:
- 128335-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa160-259 from human IGFBP1 (NP_000587) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Human IGF-BP1 is a cysteine-rich secreted protein expressed in liver, decidual, and kidneys and is the most abundant IGF-BP in amniotic fluid. Levels of IGF-BP1 in serum are lowest after food. IGF-BP1 binds both IGF-I and IGF-II with equal affinity. Phosphorylated IGF-BP1 hinders IGF actions, whereas nonphosphorylated IGF-BP1 is stimulatory. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice