IFT122 (Intraflagellar Transport Protein 122 Homolog, WD Repeat-containing Protein 10, WD Repeat-containing Protein 140, SPG, WDR10, WDR140)

Size

£685.00

SKU:: 128321
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1194-1292 from human IFT122 (NP_443711) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Required for cilia formation during neuronal patterning. Acts as a negative regulator of Shh signaling. Required to recruit TULP3 to primary cilia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.