IFNA2 (Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, MGC125764, MGC125765)

Size

£760.00

SKU:: 128277
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human IFNA2, aa-188 (NP_000596.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The IFNa family has pseudogenes in two families (I and II), one with a mature length of 166aa and one of 172aa. Cells producing IFNa are lymphocytes, monocytes, macrophages and cell lines such as Namalwa and KGI. Bioassays for IFNa include cytopathic effect blocking, by viruses such as VSV, SFV and BMCV, on their target cells. A number of receptors for IFNa are now known and seem to be expressed on most cell types. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.