HTN3 (Histatin-3, Basic Histidine-rich Protein, Hst, Histidine-rich Protein 3, PB, HIS2)

Size

£685.00

SKU:: 128160
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-51 from human HTN3 (AAH09791) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. His3-(20-43)-peptide (histatin-5) is especially effective against C.albicans and C.neoformans, and inhibits Lys-gingipain and Arg-gingipain (rgpB) from P.gingivalis. In addition, His3-(20-43)-peptide is a potent inhibitor of metalloproteinases MMP2 and MMP9. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.