HSPE1 (10kD Heat Shock Protein, Mitochondrial, 10kD Chaperonin, Chaperonin 10, CPN10, Early-pregnancy Factor, EPF)

Size

£685.00

SKU:: 128154
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-102 from human HSPE1 (AAH23518) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C11-B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.