HSPB8 (Heat Shock Protein beta-8, HspB8, Alpha-crystallin C Chain, E2-induced Gene 1 Protein, Protein Kinase H11, Small Stress Protein-like Protein HSP22, CRYAC, E2IG1, HSP22, PP1629)

Size

£685.00

SKU:: 128141
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa97-197 from human HSPB8 (NP_055180) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Displays temperature-dependent chaperone activity. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.