128119
HSP40 (DnaJ Homolog Subfamily B Member 1, Heat Shock 40kD Protein 1, Heat Shock Protein 40, DnaJ Protein Homolog 1, Human DnaJ Protein 1, hDj-1, DNAJB1, DNAJ1, HDJ1, HSPF1) (Not for Export EU)
Size
£760.00
- SKU:
- 128119
- Application:
- IP
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human DNAJB1, aa1-340 (NP_006136.1).
- Format:
- Supplied as a liquid.
- Extra Details:
- The Hsp40 (heat shock protein with molecular size of approximately 40kD) is one of the mammalian homologues of bacterial DnaJ heat shock protein. Ohtsuka (1993) isolated a cDNA encoding a 40kD heat-shock protein designated HSPF1. The deduced 340aa HSPF1 protein is 34% identical to E. coli DnaJ and 34% and 36% identical to HSJ1 and HSJ2, respectively. HSPF1 gene spans over 7kb and contains 3 exons and 2 introns. HSPF1 gene is mapped to chromosome 19p13.2. Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice