HSD3B2 (HSDB3B, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 2, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type II, 3-beta-HSD Adrenal and Gonadal Type, 3-beta-hydroxy-Delta(5)-steroid Dehydrogenase, 3-beta-hydroxy-5-ene Steroid Dehydrogenase, Progesterone Reductase, Steroid Delta-isomerase, Delta-5-3-ketosteroid Isomerase)

Size

£685.00

SKU:: 128106
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa33-122 from human HSD3B2 (NP_000189.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.