HSD17B7 (3-keto-steroid Reductase, 17-beta-hydroxysteroid Dehydrogenase 7, 17-beta-HSD 7, Estradiol 17-beta-dehydrogenase 7, UNQ2563/PRO6243, MGC12523, MGC75018, PRAP, SDR37C1)

Size

£685.00

SKU:: 128097
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa255-342 from human HSD17B7 (NP_057455) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Responsible for the reduction of the keto group on the C-3 of sterols. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.