128097-PE

HSD17B7 (3-keto-steroid Reductase, 17-beta-hydroxysteroid Dehydrogenase 7, 17-beta-HSD 7, Estradiol 17-beta-dehydrogenase 7, UNQ2563/PRO6243, MGC12523, MGC75018, PRAP, SDR37C1) (PE)

Size

£914.00

SKU:: 128097-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa255-342 from human HSD17B7 (NP_057455) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Responsible for the reduction of the keto group on the C-3 of sterols. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.