HSD17B2 (EDH17B2, Estradiol 17-beta-dehydrogenase 2, 17-beta-hydroxysteroid Dehydrogenase Type 2, 20 alpha-hydroxysteroid Dehydrogenase, E2DH, Microsomal 17-beta-hydroxysteroid Dehydrogenase, Testosterone 17-beta-dehydrogenase)

Size

£685.00

SKU:: 128088
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human HSD17B2, aa1-387 (NP_002144.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: HSD17B2 is capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone.HSD17B2 also has 20-alpha-HSD activity. HSD17B2 uses NADH while EDH17B3 uses NADPH. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.