HSD17B1 (E17KSR, EDH17B1, EDH17B2, EDHB17, Estradiol 17-beta-dehydrogenase 1, 17-beta-HSD 1, 20 alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, E2DH, Placental 17-beta-hydroxysteroid Dehydrogenase, MGC138140)

Size

£685.00

SKU:: 128084
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa189-285 from human HSD17B1 (NP_000404) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Favors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.