HSBP1 (Heat Shock Factor-binding Protein 1, Nasopharyngeal Carcinoma-associated Antigen 13, NPC-A-13, HSF1BP)

Size

£685.00

SKU:: 128077
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-76 from human HSBP1 (AAH07515) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Heat shock factor binding protein 1 (HSBP1) is a 76aa protein that binds to heat shock factor 1 (HSF1), which is a transcription factor involved in the HS response. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulated HSF1 DNA-binding activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.