128077-PE

HSBP1 (Heat Shock Factor-binding Protein 1, Nasopharyngeal Carcinoma-associated Antigen 13, NPC-A-13, HSF1BP) (PE)

Size

£914.00

SKU:: 128077-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-76 from human HSBP1 (AAH07515) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Heat shock factor binding protein 1 (HSBP1) is a 76aa protein that binds to heat shock factor 1 (HSF1), which is a transcription factor involved in the HS response. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulated HSF1 DNA-binding activity. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.