HS3ST2 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 2, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 2, 3-OST-2, Heparan Sulfate 3-O-sulfotransferase 2, h3-OST-2, 3OST2, UNQ2442/PRO5004)

Size

£685.00

SKU:: 128073
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa268-367 from HS3ST2 (NP_006034) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5D5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Catalyzes the O-sulfation of glucosamine in GlcA2S-GlcNS. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.