128065-ML550

HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754) (MaxLight 550)

Size

£914.00

SKU:: 128065-ML550
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-163 from HRASLS3 (AAH01387) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B10-2D9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Extra Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. PLA2G16 specifically catalyzes the release of fatty acids from phospholipids in adipose tissue. It also has a weak lysophospholipase activity. Tumor suppressor that may be involved in interferon-dependent cell death. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice