HOXB9 (Homeobox B9, Homeobox Protein Hox-B9, Homeobox Protein Hox-2E, HOX2E, HOX2, Homeobox Protein Hox-2.5, HOX-2.5)

Size

£685.00

SKU:: 128026
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human HOXB9, aa1-250 (NP_076922.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: HOXB9 functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation, part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is expressed in whole embryos and fetuses at 5-9 weeks from conception. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.