HMOX1 (Heme Oxygenase-1, Heme Oxygenase 1, HO-1, HO, HO1)

Size

£685.00

SKU:: 127966
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human HMOX1 (NM_002133) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Heme oxygenase (HO) is the rate-limiting enzyme in the catabolism of heme that results in the release of carbon monoxide, iron and biliverdin. The products of this enzymatic reaction play important biological roles in antioxidant, anti-inflammatory and cytoprotective functions. Heme oxyganse is comprised of two isozymes, includ-ing the constitutively expressed HO-2 isozyme and the inducible HO-1 isozyme. Inducible HO-1 is expressed as an adaptive response to several stimuli, including heme, metals and hormones. The induction of HO-1 has been implicated in numerous disease states, such as transplant rejection, hypertension, atherosclerosis, Alzheimer disease, endotoxic shock, diabetes, inflammation and neurological disorders. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice