HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854)

Size

£685.00

SKU:: 127952
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-107 from human HMGA1 (NP_665906.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: It consists of a highly conserved AT-hook DNA-binding domain that mediates binding to AT-rich sequences in the minor groove of chromosomal DNA. It functions as architectural chromatin-binding transcription factor altering the conformation of DNA by modulating nuclear protein-DNA complexes. It is involved in many cellular processes including growth regulation, viral induction of beta-IFN gene and regulation of inducible gene transcription. It also physically interacts with transcription factors such as AP-1, Sp-1 and CAAT:enhancer binding protein-beta to modulate their ability to activate gene expression. It functions as a direct transcriptional target of c-Jun and c-Myc and is maximally expressed during embryonic development. Pathological role of HMGA1 include integration of retroviruses into chromosomes and enhancing metastasis of tumor cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice