127941-BIOTIN
HLX1 (H2.0-like Homeobox Protein, Homeobox Protein HB24, Homeobox Protein HLX1, HLX) (Biotin)
Size
£914.00
- SKU:
- 127941-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa176-279 from human HLX1 (NP_068777) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- HLX1 homeobox protein (H2.0-like homeobox protein) is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. HLX1 is involved in embryogenesis and hematopoiesis and is located in the nucleus. HLX1 can be found at low levels in normal B and T-cells, and at high levels in activated lymphocytes and monocytes. HLX1 can also found in thymus, tonsil, bone marrow, developing vessels, and fetal brain tissue. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice