127880-BIOTIN

HIST2H2BE (H2BFQ, Histone H2B Type 2-E, Histone H2B-GL105, Histone H2B.q, H2B, MGC119802, MGC119804, MGC129733, MGC129734) (Biotin)

Size

£914.00

SKU:: 127880-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa36-127 from HIST2H2BE (NP_003519) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice