HIPK1 (Homeodomain-interacting Protein Kinase 1, Nuclear Body-associated Kinase 2, KIAA0630, MYAK, NBAK2, MGC26642, MGC33446, MGC33548)

Size

£685.00

SKU:: 127865
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa330-430 from human HIPK1, with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: HIPK1, a nuclear serine/threonine kinase similar to the MNB/DYRK type protein kinases, has a conserved protein kinase domain that is separated from a domain that interacts with homeoproteins. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 35ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.